Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL19 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

C-C motif chemokine ligand 19

Gene Aliases

Beta chemokine exodus-3; Beta-chemokine exodus-3; CC chemokine ligand 19; C-C motif chemokine 19; chemokine (C-C motif) ligand 19; CK beta-11; CKb11; EBI1-ligand chemokine; ELC; epstein-Barr virus-induced molecule 1 ligand chemokine; exodus-3; Macrophage inflammatory protein 3 beta; macrophage inflammatory protein 3-beta; MIP-3b; MIP3B; MIP-3-beta; SCYA19; small inducible cytokine subfamily A (Cys-Cys), member 19; small-inducible cytokine A19.

Gene ID

6363

Accession Number

NP_006265

Reactivity

Homo sapiens|Human

Target

May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

Type

Protein

Source

E.coli

Sequence

GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CCL19

Protein Name

C-C motif chemokine 19

Gene Name URL

CCL19

Nucleotide Accession Number

NM_006274

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Traumatic Brain Injury Biomarker Antibody Sampler Kit
CST 55016T 1 Kit

Traumatic Brain Injury Biomarker Antibody Sampler Kit

Sign In for Pricing
View Details
Anti-Hu CD52 PE
MBS1800705-01 100 Tests

Anti-Hu CD52 PE

Sign In for Pricing
View Details
Anti-Hu CD52 PE
MBS1800705-02 5x 100 Tests

Anti-Hu CD52 PE

Sign In for Pricing
View Details
N- (2-Fluorophenyl) ethane-1-sulfonamide
UWA66280-01 100 mg

N- (2-Fluorophenyl) ethane-1-sulfonamide

Sign In for Pricing
View Details
N- (2-Fluorophenyl) ethane-1-sulfonamide
UWA66280-02 1 g

N- (2-Fluorophenyl) ethane-1-sulfonamide

Sign In for Pricing
View Details
Fmoc-N-allyl-hydroxylamine
238542-01 100 mg

Fmoc-N-allyl-hydroxylamine

Sign In for Pricing
View Details