Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSPB Recombinant Protein (Staphylococcus aureus)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Staphylococcal cysteine proteinase B; Staphylopain B.

Accession Number

WP_001088793

Reactivity

Staphylococcus aureus

Target

Cysteine protease able to degrade elastin, fibrogen, fibronectin and kininogen. Exhibits a strong preference for substrates where arginine is preceded by a hydrophobic amino acid. Promotes detachment of primary human keratinocytes. Along with other extracellular proteases is involved in colonization and infection of human tissues (By similarity) .

Type

Protein

Source

E.coli

Sequence

DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCSTFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

46.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SSPB

Protein Name

Staphopain B

Gene Name URL

SSPB

Nucleotide Accession Number

NZ_LN626917

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYTH3 AAV Vector (Mouse) (CMV)
17554105 1 µg

CYTH3 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
CEP170 Rabbit pAb
orb2717812-01 50 µL

CEP170 Rabbit pAb

Sign In for Pricing
View Details
CEP170 Rabbit pAb
orb2717812-02 100 µL

CEP170 Rabbit pAb

Sign In for Pricing
View Details
ZNF749 Protein Vector (Human) (pPM-C-HA)
51805021 500 ng

ZNF749 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
FAM5C Antibody (N-term) Blocking Peptide
MBS9228235-01 0.5 mg

FAM5C Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
FAM5C Antibody (N-term) Blocking Peptide
MBS9228235-02 5x 0.5 mg

FAM5C Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details