Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RARRES2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Retinoic acid receptor responder 2

Gene Aliases

Chemerin; HP10433; RAR-responsive protein TIG2; retinoic acid receptor responder (tazarotene induced) 2; retinoic acid receptor responder protein 2; tazarotene-induced gene 2 protein; TIG2.

Gene ID

5919

Accession Number

NP_002880

Reactivity

Homo sapiens|Human

Target

Adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1) . Its other ligands include G protein-coupled receptor 1 (GPR1) and chemokine receptor-like 2 (CCRL2) . Positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. Also acts as a proinflammatory adipokine, causing an increase in secretion of proinflammatory and prodiabetic adipokines, which further impair adipose tissue metabolic function and have negative systemic effects including impaired insulin sensitivity, altered glucose and lipid metabolism, and a decrease in vascular function in other tissues. Can have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. Acts as a chemotactic factor for leukocyte populations expressing CMKLR1, particularly immature plasmacytoid dendritic cells, but also immature myeloid DCs, macrophages and natural killer cells. Exerts an anti-inflammatory role by preventing TNF/TNFA-induced VCAM1 expression and monocytes adhesion in vascular endothelial cells. The effect is mediated via inhibiting activation of NF-kappa-B and CRK/p38 through stimulation of AKT1/NOS3 signaling and nitric oxide production. Its dual role in inflammation and metabolism might provide a link between chronic inflammation and obesity, as well as obesity-related disorders such as type 2 diabetes and cardiovascular disease. Exhibits an antimicrobial function in the skin.

Type

Protein

Source

E.coli

Sequence

ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RARRES2

Protein Name

Retinoic acid receptor responder protein 2

Gene Name URL

RARRES2

Nucleotide Accession Number

NM_002889

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SensiStain™ Anti-hCG Antibody
HY000137 0.1 mL

SensiStain™ Anti-hCG Antibody

Ask
View Details
Rabbit Polyclonal TRPM3 Antibody
NB100-98864 0.1 mL

Rabbit Polyclonal TRPM3 Antibody

Ask
View Details
Mouse MHCI/H-2I (Major Histocompatibility ComplexI) CLIA Kit
MBS2531129-01 96 Tests

Mouse MHCI/H-2I (Major Histocompatibility ComplexI) CLIA Kit

Ask
View Details
Mouse MHCI/H-2I (Major Histocompatibility ComplexI) CLIA Kit
MBS2531129-02 5x 96 Tests

Mouse MHCI/H-2I (Major Histocompatibility ComplexI) CLIA Kit

Ask
View Details
CREB antibody
MBS5309496-01 0.05 mg

CREB antibody

Ask
View Details
CREB antibody
MBS5309496-02 5x 0.05 mg

CREB antibody

Ask
View Details