Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALM Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Galactose mutarotase

Gene Aliases

Aldose 1-epimerase; aldose mutarotase; BLOCK25; epididymis secretory sperm binding protein Li 63p; GALAC4; galactomutarotase; galactose enzyme activator; galactose mutarotase; GLAT; HEL-S-63p; IBD1.

Gene ID

130589

Accession Number

NP_620156

Reactivity

Homo sapiens|Human

Target

Mutarotase converts alpha-aldose to the beta-anomer. It is active on D-glucose, L-arabinose, D-xylose, D-galactose, maltose and lactose (By similarity) .

Type

Protein

Source

E.coli

Sequence

ASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

53.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GALM

Protein Name

Aldose 1-epimerase

Gene Name URL

GALM

Nucleotide Accession Number

NM_138801

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter fetus subsp. fetus Glycine--tRNA ligase alpha subunit (glyQ)
MBS1227811-01 0.02 mg (E-Coli)

Recombinant Campylobacter fetus subsp. fetus Glycine--tRNA ligase alpha subunit (glyQ)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus Glycine--tRNA ligase alpha subunit (glyQ)
MBS1227811-02 0.02 mg (Yeast)

Recombinant Campylobacter fetus subsp. fetus Glycine--tRNA ligase alpha subunit (glyQ)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus Glycine--tRNA ligase alpha subunit (glyQ)
MBS1227811-03 0.1 mg (E-Coli)

Recombinant Campylobacter fetus subsp. fetus Glycine--tRNA ligase alpha subunit (glyQ)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus Glycine--tRNA ligase alpha subunit (glyQ)
MBS1227811-04 0.1 mg (Yeast)

Recombinant Campylobacter fetus subsp. fetus Glycine--tRNA ligase alpha subunit (glyQ)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus Glycine--tRNA ligase alpha subunit (glyQ)
MBS1227811-05 0.02 mg (Baculovirus)

Recombinant Campylobacter fetus subsp. fetus Glycine--tRNA ligase alpha subunit (glyQ)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus Glycine--tRNA ligase alpha subunit (glyQ)
MBS1227811-06 0.02 mg (Mammalian-Cell)

Recombinant Campylobacter fetus subsp. fetus Glycine--tRNA ligase alpha subunit (glyQ)

Sign In for Pricing
View Details