Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRMP1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Collapsin response mediator protein 1

Gene Aliases

Collapsin response mediator protein 1; CRMP-1; dihydropyrimidinase-like 1; dihydropyrimidinase-related protein 1; DPYSL1; DRP1; DRP-1; inactive dihydropyrimidinase; ULIP-3; unc-33-like phosphoprotein 3.

Gene ID

1400

Accession Number

NP_001014809

Reactivity

Homo sapiens|Human

Target

Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. May participate in cytokinesis.

Type

Protein

Source

E.coli

Sequence

MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

78.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CRMP1

Protein Name

Dihydropyrimidinase-related protein 1

Gene Name URL

CRMP1

Nucleotide Accession Number

NM_001014809

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (Membrane Metalloendopeptidase) (MME/1892), CF594 conjugate, 0.1mg/mL
BNC941892-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1892), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GCFC2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV762097 1.0 µg DNA

GCFC2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
KCNE4 3'UTR GFP Stable Cell Line
TU061480 1.0 mL

KCNE4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SNTN Protein Lysate (Human) with C-Ha Tag
45014031 100 µg

SNTN Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
T7-Tag (MASMTGGQQMG) (MaxLight 490) discontinued
T0230-02A-ML490 100 µL

T7-Tag (MASMTGGQQMG) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Lentiviral human SOX3 sgRNA gene knockout kit - Lentiviral human SOX3 sgRNA gene knockout kit (plasmid)
GTR15379499 1 Vial

Lentiviral human SOX3 sgRNA gene knockout kit - Lentiviral human SOX3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details