Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL14 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

C-C motif chemokine ligand 14

Gene Aliases

C-C motif chemokine 14; CC-1; CC-3; chemokine (C-C motif) ligand 14; chemokine CC-1/CC-3; chemokine CC-3; CKB1; HCC-1; HCC-1 (1-74) ; HCC-1/HCC-3; HCC-3; hemofiltrate CC chemokine 1; MCIF; NCC2; NCC-2; new CC chemokine 2; SCYA14; SCYL2; small inducible cytokine subfamily A (Cys-Cys), member 14; small-inducible cytokine A14; SY14.

Gene ID

6358

Accession Number

NP_116738

Reactivity

Homo sapiens|Human

Target

Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induces intracellular Ca (2+) changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and is inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1 (9-74) is a chemotactic factor that attracts monocytes, eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5.

Type

Protein

Source

E.coli

Sequence

TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

24.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CCL14

Protein Name

C-C motif chemokine 14

Gene Name URL

CCL14

Nucleotide Accession Number

NM_032962

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrp6 Mouse siRNA Oligo Duplex (Locus ID 16974)
SR423066 1 Kit

Lrp6 Mouse siRNA Oligo Duplex (Locus ID 16974)

Sign In for Pricing
View Details
NECP1 rabbit pAb
ES19013-01 50 µL

NECP1 rabbit pAb

Sign In for Pricing
View Details
NECP1 rabbit pAb
ES19013-02 100 µL

NECP1 rabbit pAb

Sign In for Pricing
View Details
MTHFD2 (MTHFD2L) (NM_001144978) Human Over-expression Lysate
LS441024-20ug 20 µg

MTHFD2 (MTHFD2L) (NM_001144978) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal BHMT Antibody (3D6) [mFluor Violet 450 SE]
NBP1-04264MFV450 0.1 mL

Mouse Monoclonal BHMT Antibody (3D6) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
PITX2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
36853156 3x 1.0 µg DNA

PITX2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details