Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protein E7 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Transforming protein E7

Gene Aliases

HpV16gp2; transforming protein E7.

Gene ID

1489079

Accession Number

NP_041326

Reactivity

Human papillomavirus type 16|Human Papillomavirus Type 16

Target

Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta) .

Type

Protein

Source

E.coli

Sequence

Full Length:// MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Lyophilized// PBS, 6% Trehalose (pH 7.4)

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20° C/-80° C. Our default final concentration of glycerol is 50%. _x005F Repeated freezing and thawing is not recommended. Store working aliquots at 4° C for up to one week.

Molecular Weight

15 kDa

Protein Length

Recombinant

NCBI Gene Symbol

E7

Protein Name

Protein E7

Gene Name URL

E7

Nucleotide Accession Number

NC_001526

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MRCL3 Protein
NBP1-72407-100ug 100 µg

Recombinant Human MRCL3 Protein

Sign In for Pricing
View Details
SPOCD1 Rabbit pAb, Pacific Blue conjugated
orb2846887 100 µL

SPOCD1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Elab Fluor® 488 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782L-01 20 Tests

Elab Fluor® 488 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Elab Fluor® 488 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782L-02 100 Tests

Elab Fluor® 488 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Elab Fluor® 488 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782L-03 2x 100 Tests

Elab Fluor® 488 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
CCND3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV675472 1.0 µg DNA

CCND3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details