Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA1 MORE Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Interferon alpha 1|interferon alpha 13

Gene Aliases

IFL; IFN; IFNA@; IFNA13; IFN-ALPHA; IFN-alpha-1/13; IFN-alphaD; interferon alpha 1b; interferon alpha-1/13; interferon alpha-D; interferon-alpha1; leIF D.

Gene ID

3439|3447

Accession Number

NP_008831

Reactivity

Homo sapiens|Human

Target

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Type

Protein

Source

E.coli

Sequence

CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IFNA1|IFNA13

Protein Name

Interferon alpha-1/13

Gene Name URL

IFNA1|IFNA13

Nucleotide Accession Number

NM_006900

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GlycoLinerTM Biotin Cell Surface Glycoprotein Labeling Kit, 500 Labelings
#30143 1 Kit

GlycoLinerTM Biotin Cell Surface Glycoprotein Labeling Kit, 500 Labelings

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), CF405S conjugate, 0.1mg/mL
BNC043086-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human NCAM/CD56 (Neural Cell Adhesion Molecule) CLIA Kit
E-CL-H1169-01 24 Tests

Human NCAM/CD56 (Neural Cell Adhesion Molecule) CLIA Kit

Sign In for Pricing
View Details
Human NCAM/CD56 (Neural Cell Adhesion Molecule) CLIA Kit
E-CL-H1169-02 48 Tests

Human NCAM/CD56 (Neural Cell Adhesion Molecule) CLIA Kit

Sign In for Pricing
View Details
Human NCAM/CD56 (Neural Cell Adhesion Molecule) CLIA Kit
E-CL-H1169-03 96 Tests

Human NCAM/CD56 (Neural Cell Adhesion Molecule) CLIA Kit

Sign In for Pricing
View Details
DPF2 (NM_006268) Human Over-expression Lysate
LY401888 100 µg

DPF2 (NM_006268) Human Over-expression Lysate

Sign In for Pricing
View Details