Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

U27 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Phosphoprotein P41; Polymerase accessory protein.

Reactivity

Human herpesvirus 6A|Human Herpesvirus 6A

Target

Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization.

Type

Protein

Source

Yeast

Sequence

MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEESRFERMGKQDDGKGDRSHKNDDGSALASKQEMQYKITNYMVPAKNGTAGSSLFNEKEDSESDDSMHFDYSSNPNPKRQRCVV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

46.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

U27

Protein Name

DNA polymerase processivity factor

Gene Name URL

U27

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Spon2 (NM_133903) AAV Particle
MR204867A1V 250 µL

Mouse Spon2 (NM_133903) AAV Particle

Sign In for Pricing
View Details
TWNK Polyclonal Antibody
E55A03317 100 µg

TWNK Polyclonal Antibody

Sign In for Pricing
View Details
Dnajc27 (NM_206845) Rat Tagged ORF Clone Lentiviral Particle
RR215154L4V 200 µL

Dnajc27 (NM_206845) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Synapsin-1 (SYN1) Antibody (Biotin)
abx105955-01 20 µg

Synapsin-1 (SYN1) Antibody (Biotin)

Sign In for Pricing
View Details
Synapsin-1 (SYN1) Antibody (Biotin)
abx105955-02 50 µg

Synapsin-1 (SYN1) Antibody (Biotin)

Sign In for Pricing
View Details
Synapsin-1 (SYN1) Antibody (Biotin)
abx105955-03 100 µg

Synapsin-1 (SYN1) Antibody (Biotin)

Sign In for Pricing
View Details