Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCP Recombinant Protein (Human herpesvirus 4)

Product Specifications

CAS Number

9000-83-3

Gene Name

Small capsid protein

Gene Aliases

HHV4_BFRF3; small capsid protein.

Gene ID

3783701

Accession Number

YP_401651

Reactivity

Epstein-Barr virus|Epstein-Barr Virus|Human Gammaherpesvirus 4

Target

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.

Type

Protein

Source

E.coli

Sequence

NQNNLPNDVFREAQRSYLVFLTSQFCYEEYVQRTFGVPRRQRAIDKRQRASVAGAGAHAHLGGSSATPVQQAQAAASAGTGALASSAPSTAVAQSATPSVSSSISSLRAATSGATAAASAAAAVDTGSGGGGQPHDTAPRGARKKQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BFRF3

Protein Name

Small capsomere-interacting protein

Gene Name URL

BFRF3

Nucleotide Accession Number

NC_007605

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITFG2 (Integrin-alpha FG-GAP Repeat-containing Protein 2, MDS028) (MaxLight 405) discontinued
129527-ML405 100 µL

ITFG2 (Integrin-alpha FG-GAP Repeat-containing Protein 2, MDS028) (MaxLight 405) discontinued

Sign In for Pricing
View Details
STXBP3 Polyclonal Antibody
31455-01 50 µL

STXBP3 Polyclonal Antibody

Sign In for Pricing
View Details
STXBP3 Polyclonal Antibody
31455-02 100 µL

STXBP3 Polyclonal Antibody

Sign In for Pricing
View Details
CYP11A1 Polyclonal Antibody
RD267057A-01 60 μL

CYP11A1 Polyclonal Antibody

Sign In for Pricing
View Details
CYP11A1 Polyclonal Antibody
RD267057A-02 120 μL

CYP11A1 Polyclonal Antibody

Sign In for Pricing
View Details
CYP11A1 Polyclonal Antibody
RD267057A-03 200 µL

CYP11A1 Polyclonal Antibody

Sign In for Pricing
View Details