Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGFC Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Vascular endothelial growth factor C

Gene Aliases

AW228853; flt4 ligand; flt4-L; vascular endothelial growth factor C; vascular endothelial growth factor-related protein; VEGF-; VEGF-C; VRP.

Gene ID

22341

Accession Number

NP_033532

Reactivity

Mouse|Mus musculus

Target

Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors.

Type

Protein

Source

E.coli

Sequence

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Vegfc

Protein Name

Vascular endothelial growth factor C

Gene Name URL

Vegfc

Nucleotide Accession Number

NM_009506

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tmem123 activation kit by CRISPRa
GA209020 1 Kit

Mouse Tmem123 activation kit by CRISPRa

Sign In for Pricing
View Details
RYK Human Over-expression Lysate
orb1342350 100 µg

RYK Human Over-expression Lysate

Sign In for Pricing
View Details
SPIB Polyclonal Antibody
orb618118-01 50 μL

SPIB Polyclonal Antibody

Sign In for Pricing
View Details
SPIB Polyclonal Antibody
orb618118-02 100 µL

SPIB Polyclonal Antibody

Sign In for Pricing
View Details
PADI4 Antibody (YA6877, Rabbit)
HY-P87189-01 10 µL

PADI4 Antibody (YA6877, Rabbit)

Sign In for Pricing
View Details
PADI4 Antibody (YA6877, Rabbit)
HY-P87189-02 50 μL

PADI4 Antibody (YA6877, Rabbit)

Sign In for Pricing
View Details