Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2V2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Ubiquitin conjugating enzyme E2 V2

Gene Aliases

1 alpha,25-dihydroxyvitamin D3-inducible; DDVit 1; DDVit-1; DDVIT1; EDAF-1; EDPF1; EDPF-1; enterocyte differentiation promoting factor; enterocyte differentiation-associated factor 1; enterocyte differentiation-associated factor EDAF-1; enterocyte differentiation-promoting factor 1; methyl methanesulfonate sensitive 2, S. cerevisiae, homolog of; MMS2; MMS2 homolog; ubiquitin-conjugating enzyme E2 variant 2; UEV2; UEV-2; vitamin D3-inducible protein.

Gene ID

7336

Accession Number

NP_003341

Reactivity

Homo sapiens|Human

Target

Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.

Type

Protein

Source

E.coli

Sequence

AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UBE2V2

Protein Name

Ubiquitin-conjugating enzyme E2 variant 2

Gene Name URL

UBE2V2

Nucleotide Accession Number

NM_003350

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akt Inhibitor X
T23694-01 25 mg

Akt Inhibitor X

Sign In for Pricing
View Details
Akt Inhibitor X
T23694-02 50 mg

Akt Inhibitor X

Sign In for Pricing
View Details
Akt Inhibitor X
T23694-03 100 mg

Akt Inhibitor X

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase Recombinant Rabbit mAb
orb2325330-01 25 µL

Tryptophanyl tRNA synthetase Recombinant Rabbit mAb

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase Recombinant Rabbit mAb
orb2325330-02 50 µL

Tryptophanyl tRNA synthetase Recombinant Rabbit mAb

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase Recombinant Rabbit mAb
orb2325330-03 100 µL

Tryptophanyl tRNA synthetase Recombinant Rabbit mAb

Sign In for Pricing
View Details