Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2D3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Ubiquitin conjugating enzyme E2 D3

Gene Aliases

(E3-independent) E2 ubiquitin-conjugating enzyme D3; E2 ubiquitin-conjugating enzyme D3; E2 (17) KB3; UBC4/5; UBCH5C; ubiquitin carrier protein D3; ubiquitin conjugating enzyme E2D 3; ubiquitin-conjugating enzyme E2 D3; ubiquitin-conjugating enzyme E2 (17) KB 3; ubiquitin-conjugating enzyme E2-17 kDa 3; ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5) ; ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) ; ubiquitin-protein ligase D3.

Gene ID

7323

Accession Number

NP_003331

Reactivity

Homo sapiens|Human

Target

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-, as well as 'Lys-48'-linked polyubiquitination. Cooperates with the E2 CDC34 and the SCF (FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation. Acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin. Ubiquitin chain elongation is then performed by CDC34, building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. Acts also as an initiator E2, in conjunction with RNF8, for the priming of PCNA. Monoubiquitination of PCNA, and its subsequent polyubiquitination, are essential events in the operation of the DNA damage tolerance (DDT) pathway that is activated after DNA damage caused by UV or chemical agents during S-phase. Associates with the BRCA1/BARD1 E3 ligase complex to perform ubiquitination at DNA damage sites following ionizing radiation leading to DNA repair. Targets DAPK3 for ubiquitination which influences promyelocytic leukemia protein nuclear body (PML-NB) formation in the nucleus. In conjunction with the MDM2 and TOPORS E3 ligases, functions ubiquitination of p53/TP53. Supports NRDP1-mediated ubiquitination and degradation of ERBB3 and of BRUCE which triggers apoptosis. In conjunction with the CBL E3 ligase, targets EGFR for polyubiquitination at the plasma membrane as well as during its internalization and transport on endosomes. In conjunction with the STUB1 E3 quality control E3 ligase, ubiquitinates unfolded proteins to catalyze their immediate destruction.

Type

Protein

Source

E.coli

Sequence

MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UBE2D3

Protein Name

Ubiquitin-conjugating enzyme E2 D3

Gene Name URL

UBE2D3

Nucleotide Accession Number

NM_003340

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SGPL1 Protein Lysate 20ug
IHUSGPL1PLLY20UG 20 µg

Human SGPL1 Protein Lysate 20ug

Sign In for Pricing
View Details
Berninamycin C
T125688-01 1 mg

Berninamycin C

Sign In for Pricing
View Details
Berninamycin C
T125688-02 5 mg

Berninamycin C

Sign In for Pricing
View Details
Rat CEND1 shRNA Plasmid
abx990241-01 150 µg

Rat CEND1 shRNA Plasmid

Sign In for Pricing
View Details
Rat CEND1 shRNA Plasmid
abx990241-02 300 µg

Rat CEND1 shRNA Plasmid

Sign In for Pricing
View Details
C20orf29 AAV siRNA Pooled Vector
53725161 1.0 µg

C20orf29 AAV siRNA Pooled Vector

Sign In for Pricing
View Details