Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFSF12 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

TNF superfamily member 12|TNFSF12-TNFSF13 readthrough

Gene Aliases

APO3 ligand; APO3/DR3 ligand; APO3L; DR3LG; TNF-related WEAK inducer of apoptosis; TNFSF12-TNFSF13 protein; TNLG4A; tumor necrosis factor (ligand) superfamily, member 12; tumor necrosis factor (ligand) superfamily, member 12-member 13; tumor necrosis factor ligand 4A; tumor necrosis factor ligand superfamily member 12; tumor necrosis factor superfamily member 12; TWEAK; TWE-PRIL.

Gene ID

407977|8742

Accession Number

NP_003800

Reactivity

Homo sapiens|Human

Target

Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokines. Promotes IL8 secretion.

Type

Protein

Source

E.coli

Sequence

SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TNFSF12|TNFSF12-TNFSF13

Protein Name

Tumor necrosis factor ligand superfamily member 12

Gene Name URL

TNFSF12|TNFSF12-TNFSF13

Nucleotide Accession Number

NM_003809

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPHS1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
43379151 3x 1.0 µg DNA

SEPHS1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Transthyretin (G53E) (1.0 mg) Human, Recombinant
T-506-10 1 mg

Transthyretin (G53E) (1.0 mg) Human, Recombinant

Sign In for Pricing
View Details
Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D11]
TA503745AM 100 µL

Nucleotide binding protein like (NUBPL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D11]

Sign In for Pricing
View Details
DYRK1B (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1B, Minibrain-related Kinase, Mirk Protein Kinase, MIRK) (MaxLight 405)
MBS6189894-01 0.1 mL

DYRK1B (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1B, Minibrain-related Kinase, Mirk Protein Kinase, MIRK) (MaxLight 405)

Sign In for Pricing
View Details
DYRK1B (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1B, Minibrain-related Kinase, Mirk Protein Kinase, MIRK) (MaxLight 405)
MBS6189894-02 5x 0.1 mL

DYRK1B (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1B, Minibrain-related Kinase, Mirk Protein Kinase, MIRK) (MaxLight 405)

Sign In for Pricing
View Details
2- (2,6-Dimethylpiperidin-1-yl) -2-oxoacetic acid
TFB32998-01 50 mg

2- (2,6-Dimethylpiperidin-1-yl) -2-oxoacetic acid

Sign In for Pricing
View Details