Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFF1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Trefoil factor 1

Gene Aliases

BCEI; breast cancer estrogen-inducible protein; breast cancer estrogen-inducible sequence; D21S21; gastrointestinal trefoil protein pS2; HP1.A; HPS2; pNR-2; polypeptide P1.A; protein pS2; pS2; trefoil factor 1.

Gene ID

7031

Accession Number

NP_003216

Reactivity

Homo sapiens|Human

Target

Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine.

Type

Protein

Source

E.coli

Sequence

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TFF1

Protein Name

Trefoil factor 1

Gene Name URL

TFF1

Nucleotide Accession Number

NM_003225

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Kcnab1 shRNA (UAS) - Lentiviral mouse Kcnab1 shRNA (UAS, iRFP) (25)
GTR15218066 1 Vial

Lentiviral mouse Kcnab1 shRNA (UAS) - Lentiviral mouse Kcnab1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human GRIN1 (Glutamate Receptor, Ionotropic, N-Methyl-D-Aspartate 1) ELISA Kit
EKE63181 96 Tests

Human GRIN1 (Glutamate Receptor, Ionotropic, N-Methyl-D-Aspartate 1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal MUC1 Antibody (MUC1/8109R) [DyLight 350]
NBP3-20775UV 0.1 mL

Rabbit Monoclonal MUC1 Antibody (MUC1/8109R) [DyLight 350]

Sign In for Pricing
View Details
GTF2I Recombinant Antibody, FITC Conjugated
bsm-62451R-FITC-01 20 µL

GTF2I Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
GTF2I Recombinant Antibody, FITC Conjugated
bsm-62451R-FITC-02 100 µL

GTF2I Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
Anti-mouse MHC Class II (I-A/I-E) -InVivo
C00117-01 1 mg

Anti-mouse MHC Class II (I-A/I-E) -InVivo

Sign In for Pricing
View Details