Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUB1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

SUB1 regulator of transcription

Gene Aliases

Activated RNA polymerase II transcription cofactor 4; activated RNA polymerase II transcriptional coactivator p15; p14; P15; PC4; positive cofactor 4; SUB1 homolog; SUB1 homolog, transcriptional regulator.

Gene ID

10923

Accession Number

NP_006704

Reactivity

Homo sapiens|Human

Target

General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA) .

Type

Protein

Source

E.coli

Sequence

PKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SUB1

Protein Name

Activated RNA polymerase II transcriptional coactivator p15

Gene Name URL

SUB1

Nucleotide Accession Number

NM_006713

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGAT4B Antibody
orb2682956-01 50 µL

MGAT4B Antibody

Sign In for Pricing
View Details
MGAT4B Antibody
orb2682956-02 100 µL

MGAT4B Antibody

Sign In for Pricing
View Details
MGAT4B Antibody
orb2682956-03 200 µL

MGAT4B Antibody

Sign In for Pricing
View Details
CDK5 Rabbit Polyclonal Antibody
orb625679-01 50 µg

CDK5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDK5 Rabbit Polyclonal Antibody
orb625679-02 100 µg

CDK5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1700106J16Rik ORF Vector (Mouse) (pORF)
ORF036851 1.0 µg DNA

1700106J16Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details