SKP1 Recombinant Protein (Human)
Product Specifications
CAS Number
9000-83-3
Gene Name
S-phase kinase associated protein 1
Gene Aliases
Cyclin A/CDK2-associated p19; cyclin-A/CDK2-associated protein p19; EMC19; OCP2; OCP-2; OCP-II; organ of Corti protein 2; organ of Corti protein II; p19A; p19skp1; RNA polymerase II elongation factor-like protein; RNA polymerase II elongation factor-like protein OCP2; SIII; SKP1A; S-phase kinase-associated protein 1; TCEB1L; transcription elongation factor B polypeptide 1-like.
Gene ID
6500
Accession Number
NP_008861
Reactivity
Homo sapiens|Human
Target
Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. The functional specificity of the SCF complex depends on the F-box protein as substrate recognition component. SCF (BTRC) and SCF (FBXW11) direct ubiquitination of CTNNB1 and participate in Wnt signaling. SCF (FBXW11) directs ubiquitination of phosphorylated NFKBIA. SCF (BTRC) directs ubiquitination of NFKBIB, NFKBIE, ATF4, SMAD3, SMAD4, CDC25A, FBXO5, CEP68 and probably NFKB2 (PubMed:25704143) . SCF (SKP2) directs ubiquitination of phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. SCF (SKP2) directs ubiquitination of ORC1, CDT1, RBL2, ELF4, CDKN1A, RAG2, FOXO1A, and probably MYC and TAL1. SCF (FBXW7) directs ubiquitination of cyclin E, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. SCF (FBXW2) directs ubiquitination of GCM1. SCF (FBXO32) directs ubiquitination of MYOD1. SCF (FBXO7) directs ubiquitination of BIRC2 and DLGAP5. SCF (FBXO33) directs ubiquitination of YBX1. SCF (FBXO11) directs ubiquitination of BCL6 and DTL but does not seem to direct ubiquitination of TP53. SCF (BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF (CCNF) directs ubiquitination of CCP110. SCF (FBXL3) and SCF (FBXL21) direct ubiquitination of CRY1 and CRY2. SCF (FBXO9) directs ubiquitination of TTI1 and TELO2. SCF (FBXO10) directs ubiquitination of BCL2.
Type
Protein
Source
E.coli
Sequence
PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
45.5 kDa
Protein Length
Recombinant
NCBI Gene Symbol
SKP1
Protein Name
S-phase kinase-associated protein 1
Gene Name URL
SKP1
Nucleotide Accession Number
NM_006930
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog