Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRSF1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Serine and arginine rich splicing factor 1

Gene Aliases

Alternative-splicing factor 1; ASF; pre-mRNA-splicing factor SF2, P33 subunit; serine/arginine-rich splicing factor 1; SF2; SF2p33; SFRS1; splicing factor 2; Splicing factor, arginine/serine-rich 1; splicing factor, arginine/serine-rich, 30-KD, A; SR splicing factor 1; SRp30a.

Gene ID

6426

Accession Number

NP_001071634

Reactivity

Homo sapiens|Human

Target

Plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. Interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Can stimulate binding of U1 snRNP to a 5'-splice site-containing pre-mRNA. Binds to purine-rich RNA sequences, either the octamer, 5'-RGAAGAAC-3' (r=A or G) or the decamers, AGGACAGAGC/AGGACGAAGC. Binds preferentially to the 5'-CGAGGCG-3' motif in vitro. Three copies of the octamer constitute a powerful splicing enhancer in vitro, the ASF/SF2 splicing enhancer (ASE) which can specifically activate ASE-dependent splicing. Isoform ASF-2 and isoform ASF-3 act as splicing repressors. May function as export adapter involved in mRNA nuclear export through the TAP/NXF1 pathway.

Type

Protein

Source

E.coli

Sequence

SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SRSF1

Protein Name

Serine/arginine-rich splicing factor 1

Gene Name URL

SRSF1

Nucleotide Accession Number

NM_001078166

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF21A Rabbit Polyclonal Antibody (Biotin)
orb2135795 100 µL

KIF21A Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal CEACAM1/CD66a Antibody (F7) [PE/Cy5.5]
NBP2-59673PECY55 0.1 mL

Mouse Monoclonal CEACAM1/CD66a Antibody (F7) [PE/Cy5.5]

Sign In for Pricing
View Details
PHYHIP Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-11925R-BF405 100 µL

PHYHIP Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
DHOF siRNA Oligos set (Human)
18177171 3x 5 nmol

DHOF siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant Human Pancreatic Lipase-Related Protein 2/PLRP2 (C-6His)
CA52-10ug 10 µg

Recombinant Human Pancreatic Lipase-Related Protein 2/PLRP2 (C-6His)

Sign In for Pricing
View Details
DDX21 rabbit pAb
RA24149-01 50 µL

DDX21 rabbit pAb

Sign In for Pricing
View Details