Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRSF1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Serine and arginine rich splicing factor 1

Gene Aliases

Alternative-splicing factor 1; ASF; pre-mRNA-splicing factor SF2, P33 subunit; serine/arginine-rich splicing factor 1; SF2; SF2p33; SFRS1; splicing factor 2; Splicing factor, arginine/serine-rich 1; splicing factor, arginine/serine-rich, 30-KD, A; SR splicing factor 1; SRp30a.

Gene ID

6426

Accession Number

NP_001071634

Reactivity

Homo sapiens|Human

Target

Plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. Interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Can stimulate binding of U1 snRNP to a 5'-splice site-containing pre-mRNA. Binds to purine-rich RNA sequences, either the octamer, 5'-RGAAGAAC-3' (r=A or G) or the decamers, AGGACAGAGC/AGGACGAAGC. Binds preferentially to the 5'-CGAGGCG-3' motif in vitro. Three copies of the octamer constitute a powerful splicing enhancer in vitro, the ASF/SF2 splicing enhancer (ASE) which can specifically activate ASE-dependent splicing. Isoform ASF-2 and isoform ASF-3 act as splicing repressors. May function as export adapter involved in mRNA nuclear export through the TAP/NXF1 pathway.

Type

Protein

Source

E.coli

Sequence

SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SRSF1

Protein Name

Serine/arginine-rich splicing factor 1

Gene Name URL

SRSF1

Nucleotide Accession Number

NM_001078166

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam161b sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3048004 1.0 µg DNA

Fam161b sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
HTR1D (1-18, 251-267) rabbit polyclonal antibody, Aff - Purified
AP08448PU-N 50 µg

HTR1D (1-18, 251-267) rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
STEAP4 293 Cell Lysate
402627 0.1 mg

STEAP4 293 Cell Lysate

Sign In for Pricing
View Details
ERICH1 Double Nickase Plasmid (m)
sc-433337-NIC 20 µg

ERICH1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
POLR2G, CT (POLR2G, RPB7, DNA-directed RNA polymerase II subunit RPB7, DNA-directed RNA polymerase II subunit G, RNA polymerase II 19kD subunit) (AP)
MBS6335719-01 0.2 mL

POLR2G, CT (POLR2G, RPB7, DNA-directed RNA polymerase II subunit RPB7, DNA-directed RNA polymerase II subunit G, RNA polymerase II 19kD subunit) (AP)

Sign In for Pricing
View Details
POLR2G, CT (POLR2G, RPB7, DNA-directed RNA polymerase II subunit RPB7, DNA-directed RNA polymerase II subunit G, RNA polymerase II 19kD subunit) (AP)
MBS6335719-02 5x 0.2 mL

POLR2G, CT (POLR2G, RPB7, DNA-directed RNA polymerase II subunit RPB7, DNA-directed RNA polymerase II subunit G, RNA polymerase II 19kD subunit) (AP)

Sign In for Pricing
View Details