What is the catalog number for SCO2 Recombinant Protein (Human)?

The catalog number for SCO2 Recombinant Protein (Human) is OPCA03950-100UG.

What sizes are available for SCO2 Recombinant Protein (Human)?

SCO2 Recombinant Protein (Human) is available in the following size(s): 100 µg.

Is SCO2 Recombinant Protein (Human) in stock?

SCO2 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

SCO2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Synthesis of cytochrome C oxidase 2

Gene Aliases

CEMCOX1; ECGF1; Gliostatin; MC4DN2; MYP6; PD-ECGF; Platelet-derived endothelial cell growth factor; protein SCO2 homolog, mitochondrial; SCO cytochrome c oxidase assembly protein 2; SCO cytochrome oxidase deficient homolog 2; SCO1L; SCO2, cytochrome c oxidase assembly protein; TdRPase; Thymidine phosphorylase; TP; TYMP.

Gene ID

9997

Accession Number

NP_001162580

Reactivity

Homo sapiens|Human

Target

Copper metallochaperone essential for the synthesis and maturation of cytochrome c oxidase subunit II (MT-CO2/COX2) . Involved in transporting copper to the Cu (A) site on MT-CO2/COX2 (PubMed:15229189, PubMed:17189203) . Also acts as a thiol-disulfide oxidoreductase to regulate the redox state of the cysteines in SCO1 during maturation of MT-CO2/COX2 (PubMed:19336478) .

Type

Protein

Source

E.coli

Sequence

PAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.