What is the catalog number for S100A4 Recombinant Protein (Human)?

The catalog number for S100A4 Recombinant Protein (Human) is OPCA03949-20UG.

What sizes are available for S100A4 Recombinant Protein (Human)?

S100A4 Recombinant Protein (Human) is available in the following size(s): 20 µg.

Is S100A4 Recombinant Protein (Human) in stock?

S100A4 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

S100A4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

S100 calcium binding protein A4

Gene Aliases

18A2;42A; calcium placental protein; Calvasculin; CAPL; fibroblast-specific protein-1; FSP1; leukemia multidrug resistance associated protein; malignant transformation suppression 1; Metastasin; metastasin 1; MTS1; murine placental homolog; P9KA; PEL98; placental calcium-binding protein; protein Mts1; protein S100-A4; S100 calcium-binding protein A4; S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog) .

Gene ID

6275

Accession Number

NP_002952

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.