Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

S100 calcium binding protein A1

Gene Aliases

Protein S100-A1; S100; S100 alpha; S100 calcium-binding protein A1; S-100 protein alpha chain; S-100 protein subunit alpha; S100 protein, alpha polypeptide; S100A; S100-alpha.

Gene ID

6271

Accession Number

NP_006262

Reactivity

Homo sapiens|Human

Target

Probably acts as a Ca (2+) signal transducer (PubMed:22399290) . In response to an increase in intracellular Ca (2+) levels, binds calcium which triggers a conformational change (PubMed:23351007) . This conformational change allows interaction of S1001A with specific target proteins, such as TPR-containing proteins, and the modulation of their activity (PubMed:22399290) .

Type

Protein

Source

E.coli

Sequence

GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

26.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

S100A1

Protein Name

Protein S100-A1

Gene Name URL

S100A1

Nucleotide Accession Number

NM_006271

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dextran sulfate sodium salt - MW 9,000-16,000
YD31802-01 2 g

Dextran sulfate sodium salt - MW 9,000-16,000

Sign In for Pricing
View Details
Dextran sulfate sodium salt - MW 9,000-16,000
YD31802-02 5 g

Dextran sulfate sodium salt - MW 9,000-16,000

Sign In for Pricing
View Details
Dextran sulfate sodium salt - MW 9,000-16,000
YD31802-03 10 g

Dextran sulfate sodium salt - MW 9,000-16,000

Sign In for Pricing
View Details
Dextran sulfate sodium salt - MW 9,000-16,000
YD31802-04 25 g

Dextran sulfate sodium salt - MW 9,000-16,000

Sign In for Pricing
View Details
Dextran sulfate sodium salt - MW 9,000-16,000
YD31802-05 50 g

Dextran sulfate sodium salt - MW 9,000-16,000

Sign In for Pricing
View Details
Rat Rala Pre-designed siRNA Set A
SI211578A 1 Each

Rat Rala Pre-designed siRNA Set A

Sign In for Pricing
View Details