Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB5A Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

RAB5A, member RAS oncogene family

Gene Aliases

RAB5; RAS-associated protein RAB5A; ras-related protein Rab-5A.

Gene ID

5868

Accession Number

NP_001278977

Reactivity

Homo sapiens|Human

Target

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes (PubMed:10818110, PubMed:14617813, PubMed:16410077, PubMed:15378032) . Contributes to the regulation of filopodia extension (PubMed:14978216) . Required for the exosomal release of SDCBP, CD63, PDCD6IP and syndecan (PubMed:22660413) . Regulates maturation of apoptotic cell-containing phagosomes, probably downstream of DYN2 and PIK3C3 (By similarity) .

Type

Protein

Source

E.coli

Sequence

MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RAB5A

Protein Name

Ras-related protein Rab-5A

Gene Name URL

RAB5A

Nucleotide Accession Number

NM_001292048

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDDM8 Recombinant Protein (Human)
RP063999 100 µg

IDDM8 Recombinant Protein (Human)

Sign In for Pricing
View Details
EDTA buffer pH 8.0,1000 ml
12-9160-5 5 Pouches

EDTA buffer pH 8.0,1000 ml

Sign In for Pricing
View Details
APC8 Peptide
MBS153202-01 0.05 mg

APC8 Peptide

Sign In for Pricing
View Details
APC8 Peptide
MBS153202-02 5x 0.05 mg

APC8 Peptide

Sign In for Pricing
View Details
ALAS2/ASB Rabbit Polyclonal Antibody (Fluoro488)
orb3110368 100 µg

ALAS2/ASB Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Mouse Gamma-glutamyltranspeptidase 1, GGT1 ELISA KIT
E2090Mo-01 48 Well

Mouse Gamma-glutamyltranspeptidase 1, GGT1 ELISA KIT

Sign In for Pricing
View Details