Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTHLH Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Parathyroid hormone like hormone

Gene Aliases

BDE2; HHM; osteostatin; parathyroid hormone-like hormone preproprotein; Parathyroid hormone-like protein; parathyroid hormone-like related protein; parathyroid hormone-related protein; PLP; PTHR; PTH-related protein; PTH-rP; PTHRP.

Gene ID

5744

Accession Number

NP_002811

Reactivity

Homo sapiens|Human

Target

Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Required for skeletal homeostasis. Promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. Upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath (By similarity) . Promotes colon cancer cell migration and invasion in an integrin alpha-6/beta-1-dependent manner through activation of Rac1.

Type

Protein

Source

E.coli

Sequence

AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PTHLH

Protein Name

Parathyroid hormone-related protein

Gene Name URL

PTHLH

Nucleotide Accession Number

NM_002820

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Easypro Rat Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit
FY-ER1035S 96 Well

Easypro Rat Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit

Sign In for Pricing
View Details
Boc-(S)-3-Amino-4-(2-cyano-phenyl)-butyric acid
MBS9024722-01 1 g

Boc-(S)-3-Amino-4-(2-cyano-phenyl)-butyric acid

Sign In for Pricing
View Details
Boc-(S)-3-Amino-4-(2-cyano-phenyl)-butyric acid
MBS9024722-02 5x 1 g

Boc-(S)-3-Amino-4-(2-cyano-phenyl)-butyric acid

Sign In for Pricing
View Details
8- Bromoguanosine- 5'- O- triphosphate (8-Br-GTP)
MBS256514-01 5 µmol

8- Bromoguanosine- 5'- O- triphosphate (8-Br-GTP)

Sign In for Pricing
View Details
8- Bromoguanosine- 5'- O- triphosphate (8-Br-GTP)
MBS256514-02 5x 5 µmol

8- Bromoguanosine- 5'- O- triphosphate (8-Br-GTP)

Sign In for Pricing
View Details
Human G Protein Coupled Receptor 35 (GPR35) ELISA Kit
BSKH63611-01 48 Tests

Human G Protein Coupled Receptor 35 (GPR35) ELISA Kit

Sign In for Pricing
View Details