Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTHLH Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Parathyroid hormone like hormone

Gene Aliases

BDE2; HHM; osteostatin; parathyroid hormone-like hormone preproprotein; Parathyroid hormone-like protein; parathyroid hormone-like related protein; parathyroid hormone-related protein; PLP; PTHR; PTH-related protein; PTH-rP; PTHRP.

Gene ID

5744

Accession Number

NP_002811

Reactivity

Homo sapiens|Human

Target

Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Required for skeletal homeostasis. Promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. Upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath (By similarity) . Promotes colon cancer cell migration and invasion in an integrin alpha-6/beta-1-dependent manner through activation of Rac1.

Type

Protein

Source

E.coli

Sequence

AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PTHLH

Protein Name

Parathyroid hormone-related protein

Gene Name URL

PTHLH

Nucleotide Accession Number

NM_002820

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ran Rabbit mAb
RDSA65470 100 µL

Ran Rabbit mAb

Sign In for Pricing
View Details
Lentiviral mouse Tmod1 shRNA (UAS) - Lentiviral mouse Tmod1 shRNA (UAS) (25)
GTR15192953 1 Vial

Lentiviral mouse Tmod1 shRNA (UAS) - Lentiviral mouse Tmod1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Human Cartilage PrimaCell™: Normal Articular Cartilage Growth Supplements with Serum (for 500 mL medium)
9-47043 Set

Human Cartilage PrimaCell™: Normal Articular Cartilage Growth Supplements with Serum (for 500 mL medium)

Sign In for Pricing
View Details
Nuclear Receptor subfamily 2 group F member 6 (NR2F6) Mouse ELISA Kit
F4751 96 Tests

Nuclear Receptor subfamily 2 group F member 6 (NR2F6) Mouse ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Peroxiredoxin 3 Antibody (AT1F8) [Alexa Fluor 532]
NBP3-12869AF532 0.1 mL

Mouse Monoclonal Peroxiredoxin 3 Antibody (AT1F8) [Alexa Fluor 532]

Sign In for Pricing
View Details
NSDHL Human Knockdown Lysate
LY300381 100 µg

NSDHL Human Knockdown Lysate

Sign In for Pricing
View Details