Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPS1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Phosphoribosyl pyrophosphate synthetase 1

Gene Aliases

ARTS; CMTX5; deafness 2, perceptive, congenital; deafness, X-linked 2, perceptive, congenital; DFN2; DFNX1; dJ1070B1.2 (phosphoribosyl pyrophosphate synthetase 1) ; phosphoribosyl pyrophosphate synthase I; PPRibP; PRSI; PRS-I; ribose-phosphate diphosphokinase 1; ribose-phosphate pyrophosphokinase 1.

Gene ID

5631

Accession Number

NP_001191331

Reactivity

Homo sapiens|Human

Target

Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis.

Type

Protein

Source

E.coli

Sequence

PNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

50.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PRPS1

Protein Name

Ribose-phosphate pyrophosphokinase 1

Gene Name URL

PRPS1

Nucleotide Accession Number

NM_001204402

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5A2 (NM_001001954) Human Tagged Lenti ORF Clone
RC224012L4 10 µg

OR5A2 (NM_001001954) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD28, Human/Cynomolgus/Rhesus Macaque (Biotinylated, HEK293, His-Avi)
HY-P78096-01 20 µg

CD28, Human/Cynomolgus/Rhesus Macaque (Biotinylated, HEK293, His-Avi)

Sign In for Pricing
View Details
CD28, Human/Cynomolgus/Rhesus Macaque (Biotinylated, HEK293, His-Avi)
HY-P78096-02 50 µg

CD28, Human/Cynomolgus/Rhesus Macaque (Biotinylated, HEK293, His-Avi)

Sign In for Pricing
View Details
Rab4A (Member RAS Oncogene Family, Oncogene RAB4) Recombinant, Human discontinued
R0007-10 50 µg

Rab4A (Member RAS Oncogene Family, Oncogene RAB4) Recombinant, Human discontinued

Sign In for Pricing
View Details
Mouse Monoclonal LSP1 Antibody (LSP1/3025) [Janelia Fluor 549]
NBP2-79859JF549 0.1 mL

Mouse Monoclonal LSP1 Antibody (LSP1/3025) [Janelia Fluor 549]

Sign In for Pricing
View Details
Rat Interleukin 21 CLIA Kit
MBS8426816-01 1 Kit

Rat Interleukin 21 CLIA Kit

Sign In for Pricing
View Details