Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLAUR Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Plasminogen activator, urokinase receptor

Gene Aliases

CD87; monocyte activation antigen Mo3; UPAR; U-PAR; u-plasminogen activator receptor form 2; URKR; urokinase plasminogen activator surface receptor; urokinase-type plasminogen activator (uPA) receptor.

Gene ID

5329

Accession Number

NP_001005376

Reactivity

Homo sapiens|Human

Target

Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.

Type

Protein

Source

E.coli

Sequence

LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

58.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PLAUR

Protein Name

Urokinase plasminogen activator surface receptor

Gene Name URL

PLAUR

Nucleotide Accession Number

NM_001005376

More Discoveries

Explore Other Products

Browse additional items from our catalog

DBC1 (BRINP1) (NM_014618) Human Tagged Lenti ORF Clone
RC209538L3 10 µg

DBC1 (BRINP1) (NM_014618) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human PDE1C knockdown cell line
ABC-KD11304 1 Vial

Human PDE1C knockdown cell line

Sign In for Pricing
View Details
Kininogen 1 (KNG1) Human Over-expression Lysate
orb1379142 20 µg

Kininogen 1 (KNG1) Human Over-expression Lysate

Sign In for Pricing
View Details
Sheep Activating signal cointeg or 1 complex subunit 1 (ASCC1) ELISA Kit
MBS7223380-01 48 Well

Sheep Activating signal cointeg or 1 complex subunit 1 (ASCC1) ELISA Kit

Sign In for Pricing
View Details
Sheep Activating signal cointeg or 1 complex subunit 1 (ASCC1) ELISA Kit
MBS7223380-02 96 Well

Sheep Activating signal cointeg or 1 complex subunit 1 (ASCC1) ELISA Kit

Sign In for Pricing
View Details
Sheep Activating signal cointeg or 1 complex subunit 1 (ASCC1) ELISA Kit
MBS7223380-03 5x 96 Well

Sheep Activating signal cointeg or 1 complex subunit 1 (ASCC1) ELISA Kit

Sign In for Pricing
View Details