Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGF Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Placental growth factor

Gene Aliases

D12S1900; PGFL; PIGF; placenta growth factor; placental growth factor, vascular endothelial growth factor-related protein; PLGF; PlGF-2; SHGC-10760.

Gene ID

5228

Accession Number

NP_001193941

Reactivity

Homo sapiens|Human

Target

Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth.

Type

Protein

Source

E.coli

Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PGF

Protein Name

Placenta growth factor

Gene Name URL

PGF

Nucleotide Accession Number

NM_001207012

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP30 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
49309154 3x 1.0 µg DNA

USP30 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
CIPC siRNA (Human)
MBS8208192-01 15 nmol

CIPC siRNA (Human)

Sign In for Pricing
View Details
CIPC siRNA (Human)
MBS8208192-02 30 nmol

CIPC siRNA (Human)

Sign In for Pricing
View Details
CIPC siRNA (Human)
MBS8208192-03 5x 30 nmol

CIPC siRNA (Human)

Sign In for Pricing
View Details
Lentiviral mouse Hsd17b6 shRNA (UAS) - Lentiviral mouse Hsd17b6 shRNA (UAS, iRFP) plasmid
GTR15201868 1 Vial

Lentiviral mouse Hsd17b6 shRNA (UAS) - Lentiviral mouse Hsd17b6 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Anti-Ataxin-1 ATXN1 Monoclonal Antibody
M01786 100 µL

Anti-Ataxin-1 ATXN1 Monoclonal Antibody

Sign In for Pricing
View Details