Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NGB Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Neuroglobin

Gene Aliases

Neuroglobin.

Gene ID

58157

Accession Number

NP_067080

Reactivity

Homo sapiens|Human

Target

Involved in oxygen transport in the brain. Hexacoordinate globin, displaying competitive binding of oxygen or the distal His residue to the iron atom. Not capable of penetrating cell membranes. The deoxygenated form exhibits nitrite reductase activity inhibiting cellular respiration via NO-binding to cytochrome c oxidase. Involved in neuroprotection during oxidative stress. May exert its anti-apoptotic activity by acting to reset the trigger level of mitochondrial cytochrome c release necessary to commit the cells to apoptosis.

Type

Protein

Source

E.coli

Sequence

MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NGB

Protein Name

Neuroglobin

Gene Name URL

NGB

Nucleotide Accession Number

NM_021257

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKMY1 3'UTR GFP Stable Cell Line
TU050772 1.0 mL

ANKMY1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA kit
CSB-EL023984MO-01 48 Tests

Mouse Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA kit

Sign In for Pricing
View Details
Mouse Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA kit
CSB-EL023984MO-02 96 Tests

Mouse Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA kit

Sign In for Pricing
View Details
Mouse Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA kit
CSB-EL023984MO-03 5x 96 Tests

Mouse Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA kit

Sign In for Pricing
View Details
Mouse Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA kit
CSB-EL023984MO-04 10x 96 Tests

Mouse Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ELISA kit

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Nischarin (NISCH)
MBS2040097-01 0.1 mL

FITC-Linked Polyclonal Antibody to Nischarin (NISCH)

Sign In for Pricing
View Details