Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP13 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Matrix metallopeptidase 13

Gene Aliases

CLG3; collagenase 3; MANDP1; matrix metalloproteinase 13 (collagenase 3) ; Matrix metalloproteinase-13; MDST; MMP-13.

Gene ID

4322

Accession Number

NP_002418

Reactivity

Homo sapiens|Human

Target

Plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CTGF. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CTGF. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion.

Type

Protein

Source

E.coli

Sequence

YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

58.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MMP13

Protein Name

Collagenase 3

Gene Name URL

MMP13

Nucleotide Accession Number

NM_002427

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Transgelin-3 (TAGLN3) ELISA Kit
abx517474 96 Tests

Rat Transgelin-3 (TAGLN3) ELISA Kit

Sign In for Pricing
View Details
FBL (FIB1, FLRN) discontinued
509401 100 µg

FBL (FIB1, FLRN) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal SOX17 Antibody (OTI2G8)
NBP1-47996 0.1 mL

Mouse Monoclonal SOX17 Antibody (OTI2G8)

Sign In for Pricing
View Details
RNF145 Blocking Peptide
MBS9632845-01 1 mg

RNF145 Blocking Peptide

Sign In for Pricing
View Details
RNF145 Blocking Peptide
MBS9632845-02 5x 1 mg

RNF145 Blocking Peptide

Sign In for Pricing
View Details
Anti-ADA Antibody Picoband® (monoclonal, 6D4), Dylight550 Conjugate
M00866-Dylight550 100 µg

Anti-ADA Antibody Picoband® (monoclonal, 6D4), Dylight550 Conjugate

Sign In for Pricing
View Details