Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP2K3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Mitogen-activated protein kinase kinase 3

Gene Aliases

Dual specificity mitogen-activated protein kinase kinase 3; MAP kinase kinase 3; MAPK/ERK kinase 3; MAPKK 3; MAPKK3; MEK 3; MEK3; MKK3; PRKMK3; SAPK kinase 2; SAPKK2; SAPKK-2; stress-activated protein kinase kinase 2.

Gene ID

5606

Accession Number

NP_001303261

Reactivity

Homo sapiens|Human

Target

Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14.

Type

Protein

Source

E.coli

Sequence

MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

55.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MAP2K3

Protein Name

Dual specificity mitogen-activated protein kinase kinase 3

Gene Name URL

MAP2K3

Nucleotide Accession Number

NM_001316332

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNM1P45 CRISPR Knock Out 293T Cell Line (Human)
18466141 1x 10^6 Cells / 1.0 mL

DNM1P45 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
MIR3118-3 Human qPCR Template Standard (MI0014133)
HK300726 200 Reactions

MIR3118-3 Human qPCR Template Standard (MI0014133)

Sign In for Pricing
View Details
AP1G2 Adenovirus (Mouse)
12099054 1.0 mL

AP1G2 Adenovirus (Mouse)

Sign In for Pricing
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Trp operon repressor (trpR)
MBS1122747-01 0.02 mg (E-Coli)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Trp operon repressor (trpR)

Sign In for Pricing
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Trp operon repressor (trpR)
MBS1122747-02 0.1 mg (E-Coli)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Trp operon repressor (trpR)

Sign In for Pricing
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Trp operon repressor (trpR)
MBS1122747-03 0.02 mg (Yeast)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Trp operon repressor (trpR)

Sign In for Pricing
View Details