Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP2K3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Mitogen-activated protein kinase kinase 3

Gene Aliases

Dual specificity mitogen-activated protein kinase kinase 3; MAP kinase kinase 3; MAPK/ERK kinase 3; MAPKK 3; MAPKK3; MEK 3; MEK3; MKK3; PRKMK3; SAPK kinase 2; SAPKK2; SAPKK-2; stress-activated protein kinase kinase 2.

Gene ID

5606

Accession Number

NP_001303261

Reactivity

Homo sapiens|Human

Target

Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14.

Type

Protein

Source

E.coli

Sequence

MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

55.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MAP2K3

Protein Name

Dual specificity mitogen-activated protein kinase kinase 3

Gene Name URL

MAP2K3

Nucleotide Accession Number

NM_001316332

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GCNA shRNA (UAS) - Lentiviral human GCNA shRNA (UAS, RFP) (25)
GTR15094187 1 Vial

Lentiviral human GCNA shRNA (UAS) - Lentiviral human GCNA shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
TBC1D4 Antibody, Biotin conjugated
MBS7104172-01 0.05 mg

TBC1D4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TBC1D4 Antibody, Biotin conjugated
MBS7104172-02 0.1 mg

TBC1D4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TBC1D4 Antibody, Biotin conjugated
MBS7104172-03 5x 0.1 mg

TBC1D4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ATG7 Antibody (PerCP)
orb55137 100 µg

ATG7 Antibody (PerCP)

Sign In for Pricing
View Details
PRKACA Rabbit Polyclonal Antibody (FITC)
orb2100978 100 µL

PRKACA Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details