Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAG3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Lymphocyte activating 3

Gene Aliases

CD223; lymphocyte activation gene 3 protein; lymphocyte-activation gene 3; Protein FDC.

Gene ID

3902

Accession Number

NP_002277

Reactivity

Homo sapiens|Human

Target

Involved in lymphocyte activation. Binds to HLA class-II antigens.

Type

Protein

Source

E.coli

Sequence

VPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

75.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LAG3

Protein Name

Lymphocyte activation gene 3 protein

Gene Name URL

LAG3

Nucleotide Accession Number

NM_002286

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCTA Polyclonal Antibody
A63552-020 20 µL

TCTA Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human YOD1 shRNA (UAS) - Lentiviral human YOD1 shRNA (UAS, iRFP) plasmid
GTR15131428 1 Vial

Lentiviral human YOD1 shRNA (UAS) - Lentiviral human YOD1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Samotolisib (LY3023414)
C13343-100mg 100 mg

Samotolisib (LY3023414)

Sign In for Pricing
View Details
Polyclonal Antibody to BRCA1 (Phospho-Ser988)
35-1221-100 100 µL

Polyclonal Antibody to BRCA1 (Phospho-Ser988)

Sign In for Pricing
View Details
FGF13 Antibody (RPE)
orb150656 100 µg

FGF13 Antibody (RPE)

Sign In for Pricing
View Details
BCL2A1, BH3 Domain Specific (BCL2A1, BCL2L5, BFL1, GRS, HBPA1, Bcl-2-related protein A1, Bcl-2-like protein 5, Hemopoietic-specific early response protein, Protein BFL-1, Protein GRS) (AP) discontinued
032466-AP 200 µL

BCL2A1, BH3 Domain Specific (BCL2A1, BCL2L5, BFL1, GRS, HBPA1, Bcl-2-related protein A1, Bcl-2-like protein 5, Hemopoietic-specific early response protein, Protein BFL-1, Protein GRS) (AP) discontinued

Sign In for Pricing
View Details