Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 3

Gene Aliases

Colony-stimulating factor, multiple; hematopoietic growth factor; IL-3; interleukin-3; Mast cell growth factor; mast-cell growth factor; MCGF; MULTI-CSF; multilineage-colony-stimulating factor; multipotential colony-stimulating factor; P-cell stimulating factor; P-cell-stimulating factor.

Gene ID

3562

Accession Number

NP_000579

Reactivity

Homo sapiens|Human

Target

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.

Type

Protein

Source

E.coli

Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IL3

Protein Name

Interleukin-3

Gene Name URL

IL3

Nucleotide Accession Number

NM_000588

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)
TRV-0039600-01 24 Tests

ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)

Sign In for Pricing
View Details
ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)
TRV-0039600-02 48 Tests

ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)

Sign In for Pricing
View Details
ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)
TRV-0039600-03 96 Tests

ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)

Sign In for Pricing
View Details
ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)
TRV-0039600-04 5x 96 Tests

ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)

Sign In for Pricing
View Details
ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)
TRV-0039600-05 10x 96 Tests

ELISA Kit for Platelet Derived Growth Factor Subunit B (PDGFB)

Sign In for Pricing
View Details
Phospho-KDR/FLT4 (Y1054/Y1063) Antibody
CSB-PA009643-01 50 µg

Phospho-KDR/FLT4 (Y1054/Y1063) Antibody

Sign In for Pricing
View Details