What is the catalog number for ID1 Recombinant Protein (Human)?

The catalog number for ID1 Recombinant Protein (Human) is OPCA03878-20UG.

What sizes are available for ID1 Recombinant Protein (Human)?

ID1 Recombinant Protein (Human) is available in the following size(s): 20 µg.

Is ID1 Recombinant Protein (Human) in stock?

ID1 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

ID1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Inhibitor of DNA binding 1, HLH protein

Gene Aliases

BHLHb24; class B basic helix-loop-helix protein 24; dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein) ; DNA-binding protein inhibitor ID-1; ID; inhibitor of differentiation 1; Inhibitor of DNA binding 1; inhibitor of DNA binding 1, dominant negative helix-loop-helix protein.

Gene ID

3397

Accession Number

NP_002156

Reactivity

Homo sapiens|Human

Target

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer (By similarity) .

Type

Protein

Source

E.coli

Sequence

MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.