Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDAC1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Histone deacetylase 1

Gene Aliases

GON-10; HD1; histone deacetylase 1; KDAC1; reduced potassium dependency, yeast homolog-like 1; RPD3; RPD3L1.

Gene ID

3065

Accession Number

NP_004955

Reactivity

Homo sapiens|Human

Target

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) . Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates 'Lys-310' in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Involved in CIART-mediated transcriptional repression of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex or CRY1 through histone deacetylation.

Type

Protein

Source

E.coli

Sequence

MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

71.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HDAC1

Protein Name

Histone deacetylase 1

Gene Name URL

HDAC1

Nucleotide Accession Number

NM_004964

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSH3BP1 (ABI1) (NM_001012751) Human Tagged ORF Clone Lentiviral Particle
RC214785L3V 200 µL

SSH3BP1 (ABI1) (NM_001012751) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human OPRK1 shRNA Plasmid
abx953307-01 150 µg

Human OPRK1 shRNA Plasmid

Sign In for Pricing
View Details
Human OPRK1 shRNA Plasmid
abx953307-02 300 µg

Human OPRK1 shRNA Plasmid

Sign In for Pricing
View Details
KRTAP13-3, CT (KRTAP13-3, KAP13.3, Keratin-associated protein 13-3) (MaxLight 550) discontinued
037640-ML550 100 µL

KRTAP13-3, CT (KRTAP13-3, KAP13.3, Keratin-associated protein 13-3) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Phospho-Tau (Thr205) Polyclonal Antibody, PE-Cy5 Conjugated
bs-5420R-PE-Cy5-01 20 µL

Phospho-Tau (Thr205) Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Phospho-Tau (Thr205) Polyclonal Antibody, PE-Cy5 Conjugated
bs-5420R-PE-Cy5-02 100 µL

Phospho-Tau (Thr205) Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details