Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H3F3A MORE Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

H3.3 histone A|H3.3 histone B

Gene Aliases

H3 histone family member 3A; H3 histone family member 3B; H3 histone, family 3A; H3 histone, family 3B (H3.3B) ; H3.3A; H3.3B; H3-3A; H3-3B; H3F3; H3F3A; H3F3B; histone H3.3.

Gene ID

3020|3021

Accession Number

NP_002098

Reactivity

Homo sapiens|Human

Target

Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. Constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. Deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Type

Protein

Source

E.coli

Sequence

ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

H3-3A|H3-3B

Protein Name

Histone H3.3

Gene Name URL

H3-3A|H3-3B

Nucleotide Accession Number

NM_002107

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP4F12 Rabbit pAb
E45R27879N-100 100 µL

CYP4F12 Rabbit pAb

Sign In for Pricing
View Details
SYNE2 Rabbit Polyclonal Antibody
orb1879134-01 30 µL

SYNE2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SYNE2 Rabbit Polyclonal Antibody
orb1879134-02 50 µL

SYNE2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SYNE2 Rabbit Polyclonal Antibody
orb1879134-03 100 µL

SYNE2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SYNE2 Rabbit Polyclonal Antibody
orb1879134-04 200 µL

SYNE2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADA2a (TADA2A) (NM_001166105) Human Over-expression Lysate
E45H00800-2 20 µg

ADA2a (TADA2A) (NM_001166105) Human Over-expression Lysate

Sign In for Pricing
View Details