Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H3F3A MORE Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

H3.3 histone A|H3.3 histone B

Gene Aliases

H3 histone family member 3A; H3 histone family member 3B; H3 histone, family 3A; H3 histone, family 3B (H3.3B) ; H3.3A; H3.3B; H3-3A; H3-3B; H3F3; H3F3A; H3F3B; histone H3.3.

Gene ID

3020|3021

Accession Number

NP_002098

Reactivity

Homo sapiens|Human

Target

Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. Constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. Deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Type

Protein

Source

E.coli

Sequence

ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

H3-3A|H3-3B

Protein Name

Histone H3.3

Gene Name URL

H3-3A|H3-3B

Nucleotide Accession Number

NM_002107

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCAM1 Rabbit Polyclonal Antibody (APC)
orb2608446 100 µg

NCAM1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Triobp sgRNA CRISPR Lentivector set (Mouse)
K4733601 3x 1.0 µg

Triobp sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF-3-alpha, HNF3A, HNF-3A, MGC33105, Transcription Factor 3A, TCF3A, TCF-3A) discontinued
F9045-02E 50 µg

FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF-3-alpha, HNF3A, HNF-3A, MGC33105, Transcription Factor 3A, TCF3A, TCF-3A) discontinued

Sign In for Pricing
View Details
NUMA1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61733R-BF555-01 20 µL

NUMA1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
NUMA1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61733R-BF555-02 100 µL

NUMA1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
METTL2B, NT (METTL2B, Methyltransferase-like protein 2B)
038388 200 µL

METTL2B, NT (METTL2B, Methyltransferase-like protein 2B)

Sign In for Pricing
View Details