Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDI2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

GDP dissociation inhibitor 2

Gene Aliases

Epididymis secretory sperm binding protein Li 46e; GDI-2; guanosine diphosphate dissociation inhibitor 2; HEL-S-46e; rab GDI beta; rab GDP dissociation inhibitor beta; rab GDP-dissociation inhibitor, beta; RABGDIB.

Gene ID

2665

Accession Number

NP_001108628

Reactivity

Homo sapiens|Human

Target

Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.

Type

Protein

Source

E.coli

Sequence

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

66.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GDI2

Protein Name

Rab GDP dissociation inhibitor beta

Gene Name URL

GDI2

Nucleotide Accession Number

NM_001115156

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NNMT Human Gene Knockout Kit (CRISPR)
KN200641LP 1 Kit

NNMT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ras-Related protein Rab-1A (RAB1A) Porcine ELISA Kit
G6524 96 Tests

Ras-Related protein Rab-1A (RAB1A) Porcine ELISA Kit

Sign In for Pricing
View Details
ARID1A Antibody
MBS153652-01 0.1 mg

ARID1A Antibody

Sign In for Pricing
View Details
ARID1A Antibody
MBS153652-02 5x 0.1 mg

ARID1A Antibody

Sign In for Pricing
View Details
Ras Homolog Gene Family, Member T2 Antibody
abx115065 100 µL

Ras Homolog Gene Family, Member T2 Antibody

Sign In for Pricing
View Details
Mouse SLCO1A1 siRNA
abx934200-01 15 nmol

Mouse SLCO1A1 siRNA

Sign In for Pricing
View Details