Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLT3LG Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Fms related receptor tyrosine kinase 3 ligand

Gene Aliases

FL; FLG3L; flt3 ligand; FLT3L; fms related tyrosine kinase 3 ligand; fms-related tyrosine kinase 3 ligand; SL cytokine.

Gene ID

2323

Accession Number

NP_001191431

Reactivity

Homo sapiens|Human

Target

Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.

Type

Protein

Source

E.coli

Sequence

TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FLT3LG

Protein Name

Fms-related tyrosine kinase 3 ligand

Gene Name URL

FLT3LG

Nucleotide Accession Number

NM_001204502

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Etv2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3879203 1.0 µg DNA

Etv2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Integrin β1 Rabbit mAb
E60M0470 100 µL

Integrin β1 Rabbit mAb

Sign In for Pricing
View Details
ERK1/2 Monoclonal Antibody, Biotin Conjugated
bsm-33234M-Biotin 100 µL

ERK1/2 Monoclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
PVR CRISPR All-in-one AAV vector set (with saCas9)(Rat)
38217156 3x 1.0 µg DNA

PVR CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
TMEM143 Double Nickase Plasmid (m2)
sc-427640-NIC-2 20 µg

TMEM143 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Human OR6P1 Knockout HEK293T cell line
GTR15419036 1 Vial

Human OR6P1 Knockout HEK293T cell line

Sign In for Pricing
View Details