Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF21 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Fibroblast growth factor 21

Gene Aliases

Fgf8c; fibroblast growth factor 21; fibroblast growth factor 8c.

Gene ID

56636

Accession Number

NP_064397

Reactivity

Mouse|Mus musculus

Target

Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression) . Activity probably requires the presence of KLB.

Type

Protein

Source

E.coli

Sequence

AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Fgf21

Protein Name

Fibroblast growth factor 21

Gene Name URL

Fgf21

Nucleotide Accession Number

NM_020013

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Monkeypox Virus E8L Antibody (15) [Allophycocyanin]
NBP3-30752APC 0.1 mL

Mouse Monoclonal Monkeypox Virus E8L Antibody (15) [Allophycocyanin]

Sign In for Pricing
View Details
Dog/Canine Scd163/soluble Haemoglobin Scavenger Receptor sCD163 ELISA Kit
BG-CAN10488 1 Each

Dog/Canine Scd163/soluble Haemoglobin Scavenger Receptor sCD163 ELISA Kit

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Tagatose 1,6-diphosphate aldolase (lacD)
MBS1343295-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Tagatose 1,6-diphosphate aldolase (lacD)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Tagatose 1,6-diphosphate aldolase (lacD)
MBS1343295-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Tagatose 1,6-diphosphate aldolase (lacD)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Tagatose 1,6-diphosphate aldolase (lacD)
MBS1343295-03 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Tagatose 1,6-diphosphate aldolase (lacD)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Tagatose 1,6-diphosphate aldolase (lacD)
MBS1343295-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus Tagatose 1,6-diphosphate aldolase (lacD)

Sign In for Pricing
View Details