Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Fibroblast growth factor 1

Gene Aliases

Acidic fibroblast growth factor; AFGF; beta-endothelial cell growth factor; ECGF; ECGFA; ECGFB; ECGF-beta; Endothelial cell growth factor; endothelial cell growth factor, alpha; endothelial cell growth factor, beta; FGF-1; FGFA; FGF-alpha; fibroblast growth factor 1; fibroblast growth factor 1 (acidic) ; GLIO703; HBGF1; HBGF-1; heparin-binding growth factor 1.

Gene ID

2246

Accession Number

NP_000791

Reactivity

Homo sapiens|Human

Target

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV:ITGB3. Its binding to integrin, subsequent ternary complex formation with integrin and FGFR1, and the recruitment of PTPN11 to the complex are essential for FGF1 signaling. Induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2 and AKT1 (PubMed:18441324, PubMed:20422052) . Can induce angiogenesis (PubMed:23469107) .

Type

Protein

Source

E.coli

Sequence

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FGF1

Protein Name

Fibroblast growth factor 1

Gene Name URL

FGF1

Nucleotide Accession Number

NM_000800

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Rabbit TGF?I (Transforming Growth Factor Beta Induced Protein)
E-EL-RB0845 96 Tests

ELISA kit for Rabbit TGF?I (Transforming Growth Factor Beta Induced Protein)

Sign In for Pricing
View Details
Human AMP deaminase 2 (AMPD2) ELISA Kit
MBS7211070-01 48 Well

Human AMP deaminase 2 (AMPD2) ELISA Kit

Sign In for Pricing
View Details
Human AMP deaminase 2 (AMPD2) ELISA Kit
MBS7211070-02 96 Well

Human AMP deaminase 2 (AMPD2) ELISA Kit

Sign In for Pricing
View Details
Human AMP deaminase 2 (AMPD2) ELISA Kit
MBS7211070-03 5x 96 Well

Human AMP deaminase 2 (AMPD2) ELISA Kit

Sign In for Pricing
View Details
Human AMP deaminase 2 (AMPD2) ELISA Kit
MBS7211070-04 10x 96 Well

Human AMP deaminase 2 (AMPD2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human EHD1 Protein, N-His
orb2833836-01 20 µg

Recombinant Human EHD1 Protein, N-His

Sign In for Pricing
View Details