What is the catalog number for FCER2 Recombinant Protein (Human)?

The catalog number for FCER2 Recombinant Protein (Human) is OPCA03852-1MG.

What sizes are available for FCER2 Recombinant Protein (Human)?

FCER2 Recombinant Protein (Human) is available in the following size(s): 1 mg.

Is FCER2 Recombinant Protein (Human) in stock?

FCER2 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

FCER2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Fc fragment of IgE receptor II

Gene Aliases

BLAST-2; CD23; CD23 antigen; CD23A; CLEC4J; C-type lectin domain family 4 member J; C-type lectin domain family 4, member J; Fc epsilon receptor II; Fc fragment of IgE, low affinity II, receptor for (CD23) ; FCE2; fc-epsilon-RII; IGEBF; immunoglobulin E-binding factor; immunoglobulin epsilon-chain; low affinity immunoglobulin epsilon Fc receptor; lymphocyte IgE receptor.

Gene ID

2208

Accession Number

NP_001193948

Reactivity

Homo sapiens|Human

Target

Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen) .

Type

Protein

Source

E.coli

Sequence

DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol