Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCER2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Fc fragment of IgE receptor II

Gene Aliases

BLAST-2; CD23; CD23 antigen; CD23A; CLEC4J; C-type lectin domain family 4 member J; C-type lectin domain family 4, member J; Fc epsilon receptor II; Fc fragment of IgE, low affinity II, receptor for (CD23) ; FCE2; fc-epsilon-RII; IGEBF; immunoglobulin E-binding factor; immunoglobulin epsilon-chain; low affinity immunoglobulin epsilon Fc receptor; lymphocyte IgE receptor.

Gene ID

2208

Accession Number

NP_001193948

Reactivity

Homo sapiens|Human

Target

Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen) .

Type

Protein

Source

E.coli

Sequence

DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

47 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FCER2

Protein Name

Low affinity immunoglobulin epsilon Fc receptor

Gene Name URL

FCER2

Nucleotide Accession Number

NM_001207019

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UBAP1L Protein Lysate
MBS8429407-01 0.02 mg

Human UBAP1L Protein Lysate

Sign In for Pricing
View Details
Human UBAP1L Protein Lysate
MBS8429407-02 5x 0.02 mg

Human UBAP1L Protein Lysate

Sign In for Pricing
View Details
Ostf1 (NM_148892) Rat Tagged Lenti ORF Clone
RR207342L3 10 µg

Ostf1 (NM_148892) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD200 protein, Human, Recombinant (His)
E51P90135 20 µg

CD200 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Speer2 ORF Vector (Mouse) (pORF)
ORF058303 1.0 µg DNA

Speer2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Brilliant Violet 570™ anti-human CD45RA
GT07958 100 Tests

Brilliant Violet 570™ anti-human CD45RA

Sign In for Pricing
View Details