Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tissue factor, partial Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Coagulation factor III, tissue factor

Gene Aliases

CD142; Coagulation factor III; coagulation factor III (thromboplastin, tissue factor) ; TF; TFA; Thromboplastin; tissue factor.

Gene ID

2152

Accession Number

NP_001171567

Reactivity

Homo sapiens|Human

Target

Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade.

Type

Protein

Source

E.coli

Sequence

SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

F3

Protein Name

Tissue factor

Gene Name URL

F3

Nucleotide Accession Number

NM_001178096

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1R, 2S, 5S)-2-Amino Edoxaban
TRC-E480790-10MG 10 mg

(1R, 2S, 5S)-2-Amino Edoxaban

Sign In for Pricing
View Details
MFF Rabbit Polyclonal Antibody
ER1902-93 100 µL

MFF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CYHR1 (NM_032687) Human Over-expression Lysate
LY403193 100 µg

CYHR1 (NM_032687) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PPM1M activation kit by CRISPRa
GA115166 1 Kit

Human PPM1M activation kit by CRISPRa

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), 0.2mg/mL
BNUB0806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), 0.2mg/mL

Sign In for Pricing
View Details
CDT2 (DTL) (Center) Rabbit Polyclonal Antibody
AP51328PU-N 400 µL

CDT2 (DTL) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details