Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBAG9 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Estrogen receptor binding site associated antigen 9

Gene Aliases

Cancer-associated surface antigen RCAS1; EB9; estrogen receptor-binding fragment-associated gene 9 protein; PDAF; receptor-binding cancer antigen expressed on SiSo cells.

Gene ID

9166

Accession Number

NP_001265867

Reactivity

Homo sapiens|Human

Target

May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE) -like proteases.

Type

Protein

Source

E.coli

Sequence

RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

EBAG9

Protein Name

Receptor-binding cancer antigen expressed on SiSo cells

Gene Name URL

EBAG9

Nucleotide Accession Number

NM_001278938

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM159 (NM_001301771) Human Tagged ORF Clone
RC236180 10 µg

TMEM159 (NM_001301771) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human PLEKHA3 qPCR Primer Pair
QH50785S 200 Tests

Human PLEKHA3 qPCR Primer Pair

Sign In for Pricing
View Details
ABCA8 antibody
70R-35736 100 ug

ABCA8 antibody

Sign In for Pricing
View Details
Manidipine (Manyper) 200mg
A10553-200 200 mg

Manidipine (Manyper) 200mg

Sign In for Pricing
View Details
OR7A10 CRISPR All-in-one AAV vector set (with saCas9)(Human)
35536151 3x 1.0 µg DNA

OR7A10 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Recombinant Human IL-1 alpha/ IL1A/ IL1F1 Protein Protein, GST, E.coli-500ug
QP8550-ec-500ug 500ug

Recombinant Human IL-1 alpha/ IL1A/ IL1F1 Protein Protein, GST, E.coli-500ug

Sign In for Pricing
View Details