Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYBB Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cytochrome b-245 beta chain

Gene Aliases

AMCBX2; CGD; CGD91-phox; CGDX; cytochrome b (558) subunit beta; cytochrome b-245 beta polypeptide; cytochrome b-245 heavy chain; cytochrome b558 subunit beta; GP91-1; GP91PHOX; GP91-PHOX; heme-binding membrane glycoprotein gp91phox; IMD34; NADPH oxidase 2; neutrophil cytochrome b 91 kDa polypeptide; NOX2; p22 phagocyte B-cytochrome; p91-PHOX; superoxide-generating NADPH oxidase heavy chain subunit.

Gene ID

1536

Accession Number

NP_000388

Reactivity

Homo sapiens|Human

Target

Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H (+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.

Type

Protein

Source

E.coli

Sequence

ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CYBB

Protein Name

Cytochrome b-245 heavy chain

Gene Name URL

CYBB

Nucleotide Accession Number

NM_000397

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) ZFR Polyclonal Antibody
MBS7199270 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) ZFR Polyclonal Antibody

Sign In for Pricing
View Details
LRC20 rabbit pAb
UB-GEN-11865 100 µL

LRC20 rabbit pAb

Sign In for Pricing
View Details
KCNA7 Blocking Peptide
33R-3222 100 ug

KCNA7 Blocking Peptide

Sign In for Pricing
View Details
RNU1-16P ORF Vector (Human) (pORF)
ORF029591 1.0 µg DNA

RNU1-16P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
FCGR2A Human Pre-designed siRNA Set A
HY-RS04828 1 Set

FCGR2A Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
TUBB1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
48807061 1.0 µg DNA

TUBB1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details