What is the catalog number for CYBB Recombinant Protein (Human)?

The catalog number for CYBB Recombinant Protein (Human) is OPCA03840-100UG.

What sizes are available for CYBB Recombinant Protein (Human)?

CYBB Recombinant Protein (Human) is available in the following size(s): 100 µg.

Is CYBB Recombinant Protein (Human) in stock?

CYBB Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

CYBB Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cytochrome b-245 beta chain

Gene Aliases

AMCBX2; CGD; CGD91-phox; CGDX; cytochrome b (558) subunit beta; cytochrome b-245 beta polypeptide; cytochrome b-245 heavy chain; cytochrome b558 subunit beta; GP91-1; GP91PHOX; GP91-PHOX; heme-binding membrane glycoprotein gp91phox; IMD34; NADPH oxidase 2; neutrophil cytochrome b 91 kDa polypeptide; NOX2; p22 phagocyte B-cytochrome; p91-PHOX; superoxide-generating NADPH oxidase heavy chain subunit.

Gene ID

1536

Accession Number

NP_000388

Reactivity

Homo sapiens|Human

Target

Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H (+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.

Type

Protein

Source

E.coli

Sequence

ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.