Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle)

Gene Aliases

A; acetylcholine receptor subunit alpha; Achr; Achr-1; Acra; AI385656; AI608266.

Gene ID

11435

Accession Number

NP_031415

Reactivity

Mouse|Mus musculus

Target

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Type

Protein

Source

E.coli

Sequence

SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Chrna1

Protein Name

Acetylcholine receptor subunit alpha

Gene Name URL

Chrna1

Nucleotide Accession Number

NM_007389

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Galanin (GAL) CLIA Kit
EKU08656 96 Tests

Human Galanin (GAL) CLIA Kit

Sign In for Pricing
View Details
Rat Leucocyte Antigen B27 ELISA Kit
MBS033364-01 48 Well

Rat Leucocyte Antigen B27 ELISA Kit

Sign In for Pricing
View Details
Rat Leucocyte Antigen B27 ELISA Kit
MBS033364-02 96 Well

Rat Leucocyte Antigen B27 ELISA Kit

Sign In for Pricing
View Details
Rat Leucocyte Antigen B27 ELISA Kit
MBS033364-03 5x 96 Well

Rat Leucocyte Antigen B27 ELISA Kit

Sign In for Pricing
View Details
Rat Leucocyte Antigen B27 ELISA Kit
MBS033364-04 10x 96 Well

Rat Leucocyte Antigen B27 ELISA Kit

Sign In for Pricing
View Details
Mouse SH2B2 siRNA
abx933197-01 15 nmol

Mouse SH2B2 siRNA

Sign In for Pricing
View Details