Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle)

Gene Aliases

A; acetylcholine receptor subunit alpha; Achr; Achr-1; Acra; AI385656; AI608266.

Gene ID

11435

Accession Number

NP_031415

Reactivity

Mouse|Mus musculus

Target

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Type

Protein

Source

E.coli

Sequence

SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Chrna1

Protein Name

Acetylcholine receptor subunit alpha

Gene Name URL

Chrna1

Nucleotide Accession Number

NM_007389

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYLK (Myosin Light Chain Kinase, Smooth Muscle, MLCK, smMLCK, Kinase-related Protein, KRP, Telokin, MLCK, MLCK1, MYLK1, DKFZp686I10125, FLJ12216) (HRP)
130065-HRP 100 µL

MYLK (Myosin Light Chain Kinase, Smooth Muscle, MLCK, smMLCK, Kinase-related Protein, KRP, Telokin, MLCK, MLCK1, MYLK1, DKFZp686I10125, FLJ12216) (HRP)

Sign In for Pricing
View Details
Microscope Slides Human Tongue Anterior Part TS
4040900/2 1 Each

Microscope Slides Human Tongue Anterior Part TS

Sign In for Pricing
View Details
CRBN ligand-762
HY-W953615 1 Each

CRBN ligand-762

Sign In for Pricing
View Details
GABRR3 Rabbit Polyclonal Antibody (BF680)
orb2502057 100 µL

GABRR3 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Mouse Gamma-Enolase (ENO2) CLIA Kit
abx491610-01 96 Tests

Mouse Gamma-Enolase (ENO2) CLIA Kit

Sign In for Pricing
View Details
Mouse Gamma-Enolase (ENO2) CLIA Kit
abx491610-02 5x 96 Tests

Mouse Gamma-Enolase (ENO2) CLIA Kit

Sign In for Pricing
View Details