Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD14 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

CD14 molecule

Gene Aliases

Monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein.

Gene ID

929

Accession Number

NP_000582

Reactivity

Homo sapiens|Human

Target

Coreceptor for bacterial lipopolysaccharide (PubMed:1698311, PubMed:23264655) . In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS) (PubMed:20133493, PubMed:23264655) . Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed:8612135) . Acts as a coreceptor for TLR2:TLR6 heterodimer in response to diacylated lipopeptides and for TLR2:TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway (PubMed:16880211) . Binds electronegative LDL (LDL (-) ) and mediates the cytokine release induced by LDL (-) (PubMed:23880187) .

Type

Protein

Source

E.coli

Sequence

TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

62.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CD14

Protein Name

Monocyte differentiation antigen CD14

Gene Name URL

CD14

Nucleotide Accession Number

NM_000591

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CYP4V2 Antibody
NBP1-60084 100 µL

Rabbit Polyclonal CYP4V2 Antibody

Sign In for Pricing
View Details
Culture Medium for Human Bronchial Epithelial Cells [HBE135-E6E7]
AFG-ELL-1351-01 125 mL

Culture Medium for Human Bronchial Epithelial Cells [HBE135-E6E7]

Sign In for Pricing
View Details
Culture Medium for Human Bronchial Epithelial Cells [HBE135-E6E7]
AFG-ELL-1351-02 500 mL

Culture Medium for Human Bronchial Epithelial Cells [HBE135-E6E7]

Sign In for Pricing
View Details
ASAM (CLMP) Human shRNA Lentiviral Particle (Locus ID 79827)
TL307292V 500 µL Each

ASAM (CLMP) Human shRNA Lentiviral Particle (Locus ID 79827)

Sign In for Pricing
View Details
Spen sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3793903 1.0 µg DNA

Spen sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
(4-Methyl-1H-imidazol-2-yl) methanamine dihydrochloride
FJB25027-01 250 mg

(4-Methyl-1H-imidazol-2-yl) methanamine dihydrochloride

Sign In for Pricing
View Details